Recombinant Full Length Danio Rerio Probable G Protein-Coupled Receptor 85(Gpr85) Protein, His-Tagged
Cat.No. : | RFL15682DF |
Product Overview : | Recombinant Full Length Danio rerio Probable G protein-coupled receptor 85(gpr85) Protein (Q9I919) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MANYSHAGDHNILQNVSPLATFLKLTSLGFIIGVGVVGNLLISILLVKDKSLHRAPYYFL LDLCASDILRSAICFPFVFTSVKNGSAWTYGTLTCKVIAFLGVLSCFHTAFMLFCVSVTR YLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSF RANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVPAVSQNWTFHGPGASGQA AANWLAGFGRGPTPPTLLGIRQNSNAAGRRRLLVLDEFKTEKRISRMFYIITFFFLSLWG PYLVACYWRVFARGPVIPGGYLTAAVWMSFAQAGVNPFICIFSNRELRRCFSTTLLYCRK SRLPREPYCVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpr85 |
Synonyms | gpr85; sreb2; si:dkey-223l3.1; Probable G protein-coupled receptor 85; Super conserved receptor expressed in brain 2; zSREB2 |
UniProt ID | Q9I919 |
◆ Recombinant Proteins | ||
GPR85-5494HF | Recombinant Full Length Human GPR85 Protein | +Inquiry |
RFL25445HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 85(Gpr85) Protein, His-Tagged | +Inquiry |
GPR85-1960R | Recombinant Rhesus monkey GPR85 Protein, His-tagged | +Inquiry |
Gpr85-3294M | Recombinant Mouse Gpr85 Protein, Myc/DDK-tagged | +Inquiry |
GPR85-3893M | Recombinant Mouse GPR85 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR85-5774HCL | Recombinant Human GPR85 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gpr85 Products
Required fields are marked with *
My Review for All gpr85 Products
Required fields are marked with *
0
Inquiry Basket