Recombinant Full Length Upf0365 Protein Sth520(Sth520) Protein, His-Tagged
Cat.No. : | RFL34670SF |
Product Overview : | Recombinant Full Length UPF0365 protein STH520(STH520) Protein (Q67S38) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Symbiobacterium thermophilum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MSMPGLGYLILTFVVLLLLVLFFSFVPVGLWISAAAADVRVGIFYMIGMKLRRVPPHRIV NALIKAEKAGLEISIDKLEAHYLAGGNVDRVIDALIAAQRAGIDLVFERAAAIDLAGRNV LEAVQMSVNPKVIETPVVAGVAQDGIELRAKARVTVRADINRLVGGAGEDTIIARVGEGV VSTIGSAASHKEVLENPDMISRTVLAKGLDAGTAFEIVSIDIADVDVGANIGARLRADQA EAEKVMAQAKAEERRAMAVAEEQEMRAETQRMRAKVVEAEAEVPRALAQALREGRIGVME YLMMQNLQADTAMREALGGGQRGGQPGGQDQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STH520 |
Synonyms | floA; STH520; Flotillin-like protein FloA |
UniProt ID | Q67S38 |
◆ Recombinant Proteins | ||
RFL33481SF | Recombinant Full Length Staphylococcus Aureus Antiholin-Like Protein Lrgb(Lrgb) Protein, His-Tagged | +Inquiry |
TOMM22-1042C | Recombinant Cynomolgus TOMM22 Protein, His-tagged | +Inquiry |
ELK1-235C | Recombinant Cynomolgus Monkey ELK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GUCA2B-544M | Recombinant Mouse GUCA2B Protein (22-106 aa), GST-tagged | +Inquiry |
CD68-4367H | Recombinant Human CD68 Molecule | +Inquiry |
◆ Native Proteins | ||
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
AMBP-27H | Native Human AMBP | +Inquiry |
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPK-5442HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
DBNDD1-7065HCL | Recombinant Human DBNDD1 293 Cell Lysate | +Inquiry |
ITGB3-5124HCL | Recombinant Human ITGB3 293 Cell Lysate | +Inquiry |
SPDYA-627HCL | Recombinant Human SPDYA lysate | +Inquiry |
VP0-595HCL | Recombinant Human Enterovirus 71 VP0 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STH520 Products
Required fields are marked with *
My Review for All STH520 Products
Required fields are marked with *
0
Inquiry Basket