Recombinant Full Length Upf0187 Protein Ynee(Ynee) Protein, His-Tagged
Cat.No. : | RFL17186SF |
Product Overview : | Recombinant Full Length UPF0187 protein yneE(yneE) Protein (Q8Z706) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MIVRPQQHWIRLIFVWHGSVLSKIFSRLLLNFLLSIAVIIMLPWYTMLGIKFTLAPFSIL GVAIAIFLGFRNNACYARYVEARHLWGQLMIASRSILREVKTTLPDERGIEDFVRLQIAF AHCLRMTLRRQPQTQVLGNYLDQEALQKVVASHSPANRILLLMGEWLAIRRRSGKLSDIL FHSLNNRLNDMSSVLAGCERIANTPVPFAYTLILHRTVYLFCIMLPFALVVDLHYMTPFI SVLISYTFIALDALAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDERDIPAKRIPDKR YQLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yneE |
Synonyms | yneE; STY1534; t1448; UPF0187 protein YneE |
UniProt ID | Q8Z706 |
◆ Recombinant Proteins | ||
Mt38-160M | Recombinant M Tuberculosis 38kD Antigen Protein | +Inquiry |
IRF3-2892H | Recombinant Human IRF3 Protein (Met1-Ser123), N-His tagged | +Inquiry |
PPP1R2-4281R | Recombinant Rat PPP1R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSF2-492H | Recombinant Human CSF2 Protein, Biotinylated | +Inquiry |
IL17RA-2197H | Active Recombinant Human IL17RA protein(Met1-Trp320), His-tagged | +Inquiry |
◆ Native Proteins | ||
H3N20194-213I | Native H3N2 (A/Kiev/301/94) H3N20194 protein | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPSM2-5765HCL | Recombinant Human GPSM2 293 Cell Lysate | +Inquiry |
NECAB2-533HCL | Recombinant Human NECAB2 cell lysate | +Inquiry |
EI24-6683HCL | Recombinant Human EI24 293 Cell Lysate | +Inquiry |
APEH-8798HCL | Recombinant Human APEH 293 Cell Lysate | +Inquiry |
GEMIN7-5959HCL | Recombinant Human GEMIN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yneE Products
Required fields are marked with *
My Review for All yneE Products
Required fields are marked with *
0
Inquiry Basket