Recombinant Full Length Escherichia Coli Upf0187 Protein Ynee(Ynee) Protein, His-Tagged
Cat.No. : | RFL5722EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0187 protein yneE(yneE) Protein (P76146) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MIVRPQQHWLRRIFVWHGSVLSKISSRLLLNFLFSIAVIFMLPWYTHLGIKFTLAPFSIL GVAIAIFLGFRNNAGYARYVEARKLWGQLMIASRSLLREVKTTLPDSASVREFARLQIAF AHCLRMTLRKQPQAEVLAHYLKTEDLQRVLASNSPANRILLIMGEWLAVQRRNGQLSDIL FISLNDRLNDISAVLAGCERIAYTPIPFAYTLILHRTVYLFCIMLPFALVVDLHYMTPFI SVLISYTFISLDCLAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDEAEIPAKILPDRH YQLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yneE |
Synonyms | yneE; b1520; JW5245; UPF0187 protein YneE |
UniProt ID | P76146 |
◆ Recombinant Proteins | ||
AATF-9201H | Recombinant Human AATF, GST-tagged | +Inquiry |
RAB4A-3755R | Recombinant Rhesus monkey RAB4A Protein, His-tagged | +Inquiry |
GYPE-7834H | Recombinant Human GYPE protein, His & GST-tagged | +Inquiry |
SLC25A44A-1739Z | Recombinant Zebrafish SLC25A44A | +Inquiry |
UCHL1-3091H | Recombinant Full Length Human?UCHL1 protein | +Inquiry |
◆ Native Proteins | ||
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAP30BP-2068HCL | Recombinant Human SAP30BP 293 Cell Lysate | +Inquiry |
IL1RAPL1-2740HCL | Recombinant Human IL1RAPL1 Overexpression Lysate | +Inquiry |
SIAH2-1850HCL | Recombinant Human SIAH2 293 Cell Lysate | +Inquiry |
TMA16-8023HCL | Recombinant Human C4orf43 293 Cell Lysate | +Inquiry |
FAM109B-254HCL | Recombinant Human FAM109B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yneE Products
Required fields are marked with *
My Review for All yneE Products
Required fields are marked with *
0
Inquiry Basket