Recombinant Full Length Pseudomonas Mendocina Upf0761 Membrane Protein Pmen_2988 (Pmen_2988) Protein, His-Tagged
Cat.No. : | RFL22032PF |
Product Overview : | Recombinant Full Length Pseudomonas mendocina UPF0761 membrane protein Pmen_2988 (Pmen_2988) Protein (A4XWM7) (1-405aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas mendocina |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-405) |
Form : | Lyophilized powder |
AA Sequence : | MHRRLKDWLGFWLSLYQRFIENRGAGNAAALTYTTLFAVVPMMTVTFAMLSAIPAFQGVG EEIQGFIFNNFVPSTGETVQEYLREFTAQARQLTWFGVGLLAVTAFLMLVTIEKTFNVIW RVRQPRRGMSSFLLYWAILSLGPLLLGAGFAVSTYIASLSLISGPDAVVGAKTLLAFTPL LSSIAAFTLLYAAVPNTRVPLRHALLGGLFSAILFEIAKALFGLYVRLFPGYHLIYGAFA TVPLFLVWIYLSWLIVLLGAELVYGLSQPRRWRRQPLPRALILLVVLRLLLARQQKGEAL HYAEMQRGGWSLPEDEWSEVLDFLEREHLACRASGGGWVLCRDLHNFSLHQLLECSPWPL PNLSQLPAQLDEPWYPALRQALERLQNERKEQFGVSLATWLSGPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pmen_2988 |
Synonyms | Pmen_2988; UPF0761 membrane protein Pmen_2988 |
UniProt ID | A4XWM7 |
◆ Recombinant Proteins | ||
APOB-218C | Recombinant Cattle APOB Protein, His-tagged | +Inquiry |
GCGR-2488R | Recombinant Rat GCGR Protein | +Inquiry |
CDK5R1-669H | Recombinant Human CDK5R1 | +Inquiry |
CLEC12B-1740M | Recombinant Mouse CLEC12B Protein, His (Fc)-Avi-tagged | +Inquiry |
SAOUHSC-01341-3722S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01341 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
CII-250C | Native Chicken CII | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA5-8787HCL | Recombinant Human APOA5 293 Cell Lysate | +Inquiry |
VSTM2L-376HCL | Recombinant Human VSTM2L 293 Cell Lysate | +Inquiry |
VWA5A-373HCL | Recombinant Human VWA5A 293 Cell Lysate | +Inquiry |
PSG2-2786HCL | Recombinant Human PSG2 293 Cell Lysate | +Inquiry |
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Pmen_2988 Products
Required fields are marked with *
My Review for All Pmen_2988 Products
Required fields are marked with *
0
Inquiry Basket