Recombinant Full Length Universal Stress Protein B(Uspb) Protein, His-Tagged
Cat.No. : | RFL33650YF |
Product Overview : | Recombinant Full Length Universal stress protein B(uspB) Protein (Q664F8) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pseudotuberculosis Serotype I |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uspB |
Synonyms | uspB; YPTB3811; Universal stress protein B |
UniProt ID | Q664F8 |
◆ Recombinant Proteins | ||
PHLDA2-27727TH | Recombinant Human PHLDA2, His-tagged | +Inquiry |
ATAD1-9954H | Recombinant Human ATAD1, GST-tagged | +Inquiry |
EPHA3-8547HAF555 | Recombinant Human EPHA3 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
SLC25A5-8297M | Recombinant Mouse SLC25A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKACA-7086M | Recombinant Mouse PRKACA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAT-1238HCL | Recombinant Human TAT 293 Cell Lysate | +Inquiry |
SSRP1-1456HCL | Recombinant Human SSRP1 293 Cell Lysate | +Inquiry |
S1PR1-530HCL | Recombinant Human S1PR1 cell lysate | +Inquiry |
ARNTL-8690HCL | Recombinant Human ARNTL 293 Cell Lysate | +Inquiry |
C1orf111-8186HCL | Recombinant Human C1orf111 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uspB Products
Required fields are marked with *
My Review for All uspB Products
Required fields are marked with *
0
Inquiry Basket