Recombinant Full Length Uncharacterized Sensor-Like Histidine Kinase Ycf26(Ycf26) Protein, His-Tagged
Cat.No. : | RFL31764PF |
Product Overview : | Recombinant Full Length Uncharacterized sensor-like histidine kinase ycf26(ycf26) Protein (P51392) (1-656aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porphyra purpurea (Red seaweed) (Ulva purpurea) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-656) |
Form : | Lyophilized powder |
AA Sequence : | MFSFRNQQVLTFVSSLSTFVTIILNHLKKWWSDVTLRTRLMAMTTLMVSLLMSSLTFWTL TSIQQETRLIDNRFGKDLSLLLAVNITPILEGDNYLQLQQFIEHFYLSTSSIRYILVFNA DGQIYYSIPFSSETAINFFSLSEYNCFRNENHYFSNTPIVNTNNRLQGEVIDIIIPLSKE KKLLGILNIGINSNPTLTTSSQLTRDVSVAVFISIWLMVILGAAFNAFTITRPIRELLTG VKNIASGDFYQRIDLPFGGELGALIFNFNEMAERLEKYEQQNVEKLTSEKAKLETLVSTI ADGAILLDKDLRVILVNRTAIENFGWEGKNIAGSIIVDYLPEDINQQLFPILNDIIRKNF LEQSICETQEICIKLQKNYKKTFRVLLTTVLDHKYSILKGIAMTIQDRTQEVELNEIKNQ FISNVSHELRTPLFNIRSFLETLYEYHDSLDDSQKLEFLAIANKETGRLTRLVNDVLDLS RLESDQEYTLQPTDLVSAVEQTIRTYQLSAKDKRIDLHIDIEQNLQCVLGNYNLILQILA NLVVNSLKFTHPNGIIILRAYTVDDLKTETEVQHFNSQKVRVEICDNGIGISRKNQERIF ARFLRIENYVHTLEGTGLGLSIVKNIIQKHNSEIHLYSELKNGSCFFFDLMIAKDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ycf26 |
Synonyms | ycf26; Uncharacterized sensor-like histidine kinase ycf26 |
UniProt ID | P51392 |
◆ Recombinant Proteins | ||
OSBP-8006H | Recombinant Human OSBP protein, His & T7-tagged | +Inquiry |
SETD2-199H | Active Recombinant Human SETD2 protein, GST-tagged | +Inquiry |
CDH20-1507M | Recombinant Mouse CDH20 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32598CF | Recombinant Full Length Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic(Ndhc) Protein, His-Tagged | +Inquiry |
PDCD1-1222RAF555 | Active Recombinant Monkey PDCD1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Native Proteins | ||
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMX2-899HCL | Recombinant Human TMX2 293 Cell Lysate | +Inquiry |
NUDT9-3640HCL | Recombinant Human NUDT9 293 Cell Lysate | +Inquiry |
GPCPD1-5810HCL | Recombinant Human GPCPD1 293 Cell Lysate | +Inquiry |
FSHB-6131HCL | Recombinant Human FSHB 293 Cell Lysate | +Inquiry |
RPE-1419MCL | Recombinant Mouse RPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ycf26 Products
Required fields are marked with *
My Review for All ycf26 Products
Required fields are marked with *
0
Inquiry Basket