Recombinant Full Length Uncharacterized Protein Zk757.4(Zk757.4) Protein, His-Tagged
Cat.No. : | RFL36796CF |
Product Overview : | Recombinant Full Length Uncharacterized protein ZK757.4(ZK757.4) Protein (Q8I0G4) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MSCRDCTRKGGCVYTTFWLVRFLPVVLVSLATGWGIYAYTYELCILSIDNWPQRIIYLFI FYALLILFYTSYLRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDL TLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILF LAYGFIFCIWIAATTLPSFIDFWRHEYDMNKKQYDSIDSVIQRNLKHLHTVLSNGRFPLV FLLFLSCMFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHGIRANYREIF GSHPLYWFLPVPSSIGDGCKFVMNDMTAMSAAAGNQVFVEMGNVPNGQSHAHPPIAQHHI NLYSEQSSSASEKEIKSVDDEITERSQVSTATTASPSHDSVTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dhhc-4 |
Synonyms | dhhc-4; ZK757.4; Zinc finger DHHC domain-containing protein 4 |
UniProt ID | Q8I0G4 |
◆ Recombinant Proteins | ||
Ager-3304M | Recombinant Mouse Ager protein(Met1-Ala342), His-tagged | +Inquiry |
RFL24159SF | Recombinant Full Length Saccharomyces Cerevisiae Putative Meiotic Phospholipase Spo1(Spo1) Protein, His-Tagged | +Inquiry |
FAM187A-2228R | Recombinant Rat FAM187A Protein | +Inquiry |
ABLIM2-109H | Recombinant Human ABLIM2 Protein, GST-Tagged | +Inquiry |
CTU2-4069M | Recombinant Mouse CTU2 Protein | +Inquiry |
◆ Native Proteins | ||
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
YPEL1-241HCL | Recombinant Human YPEL1 293 Cell Lysate | +Inquiry |
CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
PC-12-015WCY | Rat adrenal pheochromocytoma PC-12 Whole Cell Lysate | +Inquiry |
VAT1-425HCL | Recombinant Human VAT1 293 Cell Lysate | +Inquiry |
GLIS1-5901HCL | Recombinant Human GLIS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dhhc-4 Products
Required fields are marked with *
My Review for All dhhc-4 Products
Required fields are marked with *
0
Inquiry Basket