Recombinant Full Length Uncharacterized Protein Rv1518/Mt1568(Rv1518, Mt1568) Protein, His-Tagged
Cat.No. : | RFL548HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv1518/MT1568(Rv1518, MT1568) Protein (Q50590) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MVPGDASSVVSVNPAKPLISVCIPMYNNGATIERCLRSILEQEGVEFEIVVVDDDSSDDC AAIAATMLRPGDRLLRNEPRLGLNRNHNKCLEVARGGLIQFVHGDDRLLPGALQTLSRRF EDPSVGMAFAPRRVESDDIKWQQRYGRVHTRFRKLRDRNHGPSLVLQMVLHGAKENWIGE PTAVMFRRQLALDAGGFRTDIYQLVDVDFWLRLMLRSAVCFVPHELSVRRHTAATETTRV MATRRNVLDRQRILTWLIVDPLSPNSVRSAAALWWIPAWLAMIVEVAVLGPQRRTHLKAL APAPFREFAHARRQLPMAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv1518/MT1568(Rv1518, MT1568) |
UniProt ID | Q50590 |
◆ Native Proteins | ||
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR1-7698HCL | Recombinant Human CCR1 293 Cell Lysate | +Inquiry |
Spleen-472M | Mouse Spleen Membrane Lysate | +Inquiry |
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
KCNT2-5013HCL | Recombinant Human KCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv1518/MT1568(Rv1518, MT1568) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv1518/MT1568(Rv1518, MT1568) Products
Required fields are marked with *
0
Inquiry Basket