Recombinant Dog TFF3 protein, His-tagged
Cat.No. : | TFF3-6322D |
Product Overview : | Recombinant Dog TFF3 protein(Q863B4)(24-80aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-80aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 9.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF |
Gene Name | TFF3 trefoil factor 3 (intestinal) [ Canis lupus familiaris ] |
Official Symbol | TFF3 |
Synonyms | TFF3; trefoil factor 3 (intestinal); trefoil factor 3; intestinal trefoil factor; trefoil factor family peptide 3; ITF; |
Gene ID | 403488 |
mRNA Refseq | NM_001002990 |
Protein Refseq | NP_001002990 |
◆ Recombinant Proteins | ||
TFF3-6422H | Recombinant Human TFF3 Protein (Met22-Val80), N-GST tagged | +Inquiry |
TFF3-6030R | Recombinant Rat Tff3 protein, Flag-tagged | +Inquiry |
TFF3-3204H | Recombinant Human TFF3, GST-tagged | +Inquiry |
TFF3-973H | Recombinant Human Trefoil Factor 3 | +Inquiry |
TFF3-16692M | Recombinant Mouse Tff3 protein, His/Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFF3 Products
Required fields are marked with *
My Review for All TFF3 Products
Required fields are marked with *
0
Inquiry Basket