Recombinant Full Length Uncharacterized Protein Mb0921C (Mb0921C) Protein, His-Tagged
Cat.No. : | RFL19776MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb0921c (Mb0921c) Protein (P64752) (1-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-535) |
Form : | Lyophilized powder |
AA Sequence : | MSDHDRDFDVVVVGGGHNGLVAAAYLARAGLRVRLLERLAQTGGAAVSIQAFDGVEVALS RYSYLVSLLPSRIVADLGAPVRLARRPFSSYTPAPATAGRSGLLIGPTGEPRAAHLAAIG AAPDAHGFAAFYRRCRLVTARLWPTLIEPLRTREQARRDIVEYGGHEAAAAWQAMVDEPI GHAIAGAVANDLLRGVIATDALIGTFARMHEPSLMQNICFLYHLVGGGTGVWHVPIGGMG SVTSALATAAARHGAEIVTGADVFALDPDGTVRYHSDGSDGAEHLVRGRFVLVGVTPAVL ASLLGEPVAALAPGAQVKVNMVVRRLPRLRDDSVTPQQAFAGTFHVNETWSQLDAAYSQA ASGRLPDPLPCEAYCHSLTDPSILSARLRDAGAQTLTVFGLHTPHSVFGDTEGLAERLTA AVLASLNSVLAEPIQDVLWTDAQSKPCIETTTTLDLQRTLGMTGGNIFHGALSWPFADND DPLDTPARQWGVATDHERIMLCGSGARRGGAVSGIGGHNAAMAVLACLASRRKSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB0921C |
Synonyms | BQ2027_MB0921C; Uncharacterized protein Mb0921c |
UniProt ID | P64752 |
◆ Native Proteins | ||
IGHD -21H | Native Human IgD | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNA11-5872HCL | Recombinant Human GNA11 293 Cell Lysate | +Inquiry |
CHRDL1-7523HCL | Recombinant Human CHRDL1 293 Cell Lysate | +Inquiry |
Heart-083RCL | Adult Rat Heart Whole Cell Lysate | +Inquiry |
FRK-6137HCL | Recombinant Human FRK 293 Cell Lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB0921C Products
Required fields are marked with *
My Review for All BQ2027_MB0921C Products
Required fields are marked with *
0
Inquiry Basket