Recombinant Full Length Hordeum Vulgare Cytochrome C Biogenesis Protein Ccsa(Ccsa) Protein, His-Tagged
Cat.No. : | RFL33374HF |
Product Overview : | Recombinant Full Length Hordeum vulgare Cytochrome c biogenesis protein ccsA(ccsA) Protein (A1E9N9) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hordeum vulgare (Barley) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MLFATLEHILTHISFSTISIVITIHLITLLVRELGRLRDSSEKGMIVTFFSITGFLVSRW VSSGHFPLSNLYESLIFLSWALYILHTIPKIQNSKNDLSTITTPSTILTQGFATSGLLTE MHQSTILVPALQSQWLMMHVSMMLLSYATLLCGSLLSAAILIIRFRNNFHFFSKKKKNVL NKTFFFSEIAFFYAKRSALKSAPVPSFPNYYKYQLTERLDSWSYRIISLGFTLLTIGILC GAVWANEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTNSALIASIGFLIIWIC YFGINLLGIGLHSYGSFTLTPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsA |
Synonyms | ccsA; Cytochrome c biogenesis protein CcsA |
UniProt ID | A1E9N9 |
◆ Native Proteins | ||
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
Prothrombin-293M | Native Mouse Prothrombin Frag-1 | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATHL1-8619HCL | Recombinant Human ATHL1 293 Cell Lysate | +Inquiry |
CDC40-7658HCL | Recombinant Human CDC40 293 Cell Lysate | +Inquiry |
GEN1-5957HCL | Recombinant Human GEN1 293 Cell Lysate | +Inquiry |
COPS5-7356HCL | Recombinant Human COPS5 293 Cell Lysate | +Inquiry |
AP1G1-8819HCL | Recombinant Human AP1G1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsA Products
Required fields are marked with *
My Review for All ccsA Products
Required fields are marked with *
0
Inquiry Basket