Recombinant Full Length Uncharacterized Abc Transporter Atp-Binding Protein Mb1304C (Mb1304C) Protein, His-Tagged
Cat.No. : | RFL34589MF |
Product Overview : | Recombinant Full Length Uncharacterized ABC transporter ATP-binding protein Mb1304c (Mb1304c) Protein (P0A4W5) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MLLALLRQHIRPYRRLVAMLMMLQLVSTLASLYLPTVNAAIVDDGVAKGDTATIVRLGAV MLGVTGLQVLCAIGAVYLGSRTGAGFGRDLRSAMFEHIITFSERETARFGAPTLLTRSTN DVRQILFLVQMTATVLVTAPIMCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHML PLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANTALSNAALSAGNWQAL MLPVTTLTINASSVALIWFGGLRIDSGQMQVGSLIAFLSYFAQILMAVLMATMTLAVLPR ASVCAERITEVLSTPAALGNPDNPKFPTDGVTGVVRLAGATFTYPGADCPVLQDISLTAR PGTTTAIVGSTGSGKSTLVSLICRLYDVTAGAVLVDGIDVREYHTERLWSAIGLVPQRSY LFSGTVADNLRYGGGPDQVVTEQEMWEALRVAAADGFVQTDGLQTRVAQGGVNFSGGQRQ RLAIARAVIRRPAIYVFDDAFSALDVHTDAKVHASLRQVSGDATIIVVTQRISNAAQADQ VIVVDNGKIVGTGTHETLLADCPTYAEFAASQSLSATVGGVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB1304C |
Synonyms | BQ2027_MB1304C; Uncharacterized ABC transporter ATP-binding protein Mb1304c |
UniProt ID | P0A4W5 |
◆ Native Proteins | ||
KRT19-382H | Native Human KRT19 | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
LDH-17H | Active Native Human Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCHE-2286MCL | Recombinant Mouse BCHE cell lysate | +Inquiry |
DSC2-1159RCL | Recombinant Rat DSC2 cell lysate | +Inquiry |
CCBP2-7795HCL | Recombinant Human CCBP2 293 Cell Lysate | +Inquiry |
BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
SLC35B2-606HCL | Recombinant Human SLC35B2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB1304C Products
Required fields are marked with *
My Review for All BQ2027_MB1304C Products
Required fields are marked with *
0
Inquiry Basket