Recombinant Full Length Porcine Transmissible Gastroenteritis Coronavirus Membrane Protein(M) Protein, His-Tagged
Cat.No. : | RFL31740PF |
Product Overview : | Recombinant Full Length Porcine transmissible gastroenteritis coronavirus Membrane protein(M) Protein (P09175) (18-262aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine transmissible gastroenteritis coronavirus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-262) |
Form : | Lyophilized powder |
AA Sequence : | RYCAMKDDTGLSCRNSTASACESCFNGGDLIWHLANWNFSWSIILIIFITVLQYGRPQFS WFVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGVSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPEINAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTDARTDNLSEQEK LLHMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein |
UniProt ID | P09175 |
◆ Recombinant Proteins | ||
FDXR-4777HF | Recombinant Full Length Human FDXR Protein, GST-tagged | +Inquiry |
IRAK4-1168H | Recombinant Human IRAK4 Protein (E154-S460), Tag Free | +Inquiry |
CYP2D17-443C | Recombinant Cynomolgus CYP2D17 Protein, His-tagged | +Inquiry |
THPO-82H | Active Recombinant Human Thrombopoietin | +Inquiry |
MMS19-5441H | Recombinant Human MMS19 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRM1-4201HCL | Recombinant Human MRM1 293 Cell Lysate | +Inquiry |
C8orf48-133HCL | Recombinant Human C8orf48 lysate | +Inquiry |
TBC1D13-1230HCL | Recombinant Human TBC1D13 293 Cell Lysate | +Inquiry |
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
FKRP-6199HCL | Recombinant Human FKRP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket