Recombinant Full Length Type Iv Secretion System Protein Ptlb Homolog(Ptlb) Protein, His-Tagged
Cat.No. : | RFL18255BF |
Product Overview : | Recombinant Full Length Type IV secretion system protein ptlB homolog(ptlB) Protein (Q7W2U4) (1-104aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella parapertussis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-104) |
Form : | Lyophilized powder |
AA Sequence : | MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ptlB |
Synonyms | ptlB; BPP4310; Type IV secretion system protein PtlB homolog |
UniProt ID | Q7W2U4 |
◆ Native Proteins | ||
FGA-34D | Native Canine Fibrinogen | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
ZWILCH-2103HCL | Recombinant Human ZWILCH cell lysate | +Inquiry |
PANK2-3445HCL | Recombinant Human PANK2 293 Cell Lysate | +Inquiry |
ACSL5-9073HCL | Recombinant Human ACSL5 293 Cell Lysate | +Inquiry |
NAA30-432HCL | Recombinant Human NAA30 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ptlB Products
Required fields are marked with *
My Review for All ptlB Products
Required fields are marked with *
0
Inquiry Basket