Recombinant Bacillus Subtilis YOAJ Protein (26-232 aa), His-tagged
Cat.No. : | YOAJ-1641B |
Product Overview : | Recombinant Bacillus Subtilis (strain 168) YOAJ Protein (26-232 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Subtilis |
Source : | Yeast |
Tag : | His |
Protein Length : | 26-232 aa |
Description : | May promote colonization of plant roots. May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. Has very low expansin activity (in vitro). No enzymatic activity has been found. Binds to peptidoglycan and to plant cell walls. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.9 kDa |
AA Sequence : | AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | yoaJ; EXLX1; |
UniProt ID | O34918 |
◆ Recombinant Proteins | ||
YOAJ-1641B | Recombinant Bacillus Subtilis YOAJ Protein (26-232 aa), His-tagged | +Inquiry |
YOAJ-985B | Recombinant Bacillus Subtilis YOAJ Protein (26-232 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YOAJ Products
Required fields are marked with *
My Review for All YOAJ Products
Required fields are marked with *
0
Inquiry Basket