Recombinant Full Length Type Iv Pilus Assembly Protein Tapc(Tapc) Protein, His-Tagged
Cat.No. : | RFL8104AF |
Product Overview : | Recombinant Full Length Type IV pilus assembly protein TapC(tapC) Protein (P45793) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aeromonas hydrophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MATLTQKQNAPKKVFAFRWSGVNRKGQKVSGELQADSINTVKAELRKQGVNVTKVSKKSQ GLFSKGGAKIKPMDIAIVSRQITTMLSAGVPLVQSLQIIARSHEKASMRELMGQIAADVE TGTPMSEALRRHPRHFDALYCDLVEAGEQSGALETIYDRIATYREKSEALKSKIKKAMFY PAMVILVAIVVTSILLLFVIPQFEDIFKSFGAELPIFTQFVIGISRFMQHWWYVIFGGTA FAIFLYVRAWRASQKVKDNTDKFILTIPVVGMILHKAAMARFARTLSTTFSAGIPLVDAL ISAAGASGNYVYRTAVMAIRNEVVAGMQINVAMRTVDLFPDMVIQMVMIGEESGAIDDML SKVATIFEQEVDDLVDGLTSLLEPLIMVVLGVLVGGMVVAMYLPIFKLGDLVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tapC |
Synonyms | tapC; Type IV pilus assembly protein TapC |
UniProt ID | P45793 |
◆ Native Proteins | ||
AC-62H | Native Human Activated Protein C | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
CKMB-165H | Active Native Human Creatine Kinase MB | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASF1B-001HCL | Recombinant Human ASF1B cell lysate | +Inquiry |
PLAG1-3134HCL | Recombinant Human PLAG1 293 Cell Lysate | +Inquiry |
CLDN17-7467HCL | Recombinant Human CLDN17 293 Cell Lysate | +Inquiry |
PTPN23-1438HCL | Recombinant Human PTPN23 cell lysate | +Inquiry |
NLN-3806HCL | Recombinant Human NLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tapC Products
Required fields are marked with *
My Review for All tapC Products
Required fields are marked with *
0
Inquiry Basket