Recombinant Full Length Twik Family Of Potassium Channels Protein 9(Twk-9) Protein, His-Tagged
Cat.No. : | RFL12569CF |
Product Overview : | Recombinant Full Length TWiK family of potassium channels protein 9(twk-9) Protein (Q23435) (1-568aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-568) |
Form : | Lyophilized powder |
AA Sequence : | MKCSFHIPEKYQWASTLFVHVALIAGVAVYTVFGALSMQWLESPDRVRALLKRELKPVES LPPPPSISGLPDRITRVYLGEELAILDPGVHECLERTILTLFHDTKCDPYSFEHLNIELI DRCYAEANVPIPEGYGGQPRKKIKNKEEEKDVIDETPAEKWSIGNSVIFAFTVITTIGYG HVAPETFEGRLFLIFYGVIGVPFTLLTIADLGMFLTRFLKNLLTMARRFAHYLVKLYQKA KKQRNKSQKTSPVMPDSERSEVWNTGKEMKEMSMRTAREPGEGDEIEVIENGNDENGKEE DEEEPENNEPRKTEESIALGITFTCYLVAGAKILSVYEPEMDFFKALYFNFVTLTTIGLG DFVPKSFDYLLITLIYIGIGLALTTMAIEIAADLLKKLHYIGRKMENVGQAVVWFGGKKM TMKSLVKHLGDQFNIPEEELANFDMSAFVDNAIKVEKGEIATLRKPPTPPVVFRERAFSF SNVRNSSESALKYVDDNRFSKTTQPTIYTVIIHETTRTIDTLHNLADAIRRDPSIPRLDL DVHYLTDMSAPTSFDENYLRTYTNARRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | twk-9 |
Synonyms | twk-9; ZK1251.8; TWiK family of potassium channels protein 9 |
UniProt ID | Q23435 |
◆ Recombinant Proteins | ||
MLXIP-5400H | Recombinant Human MLXIP Protein, GST-tagged | +Inquiry |
TMEM108-9278M | Recombinant Mouse TMEM108 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNG7-1076R | Recombinant Rat CACNG7 Protein | +Inquiry |
SYNJ2-2147H | Recombinant Human SYNJ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9551NF | Recombinant Full Length Neisseria Meningitidis Serogroup A / Serotype 4A Uncharacterized Protein Nma0420 (Nma0420) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Chitosan-002C | Native Crawfish Chitosan | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXLNA-629HCL | Recombinant Human TXLNA 293 Cell Lysate | +Inquiry |
ITGA2-5135HCL | Recombinant Human ITGA2 293 Cell Lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
SPATA45-8162HCL | Recombinant Human C1orf227 293 Cell Lysate | +Inquiry |
CDC16-7670HCL | Recombinant Human CDC16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All twk-9 Products
Required fields are marked with *
My Review for All twk-9 Products
Required fields are marked with *
0
Inquiry Basket