Recombinant Human MLXIP Protein, GST-tagged

• Cat.No.: MLXIP-5400H
• Product Overview: Human MLXIP partial ORF ( NP_055753.2, 481 a.a. - 577 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes (Billin et al., 2000 [PubMed 11073985]).[supplied by OMIM
• Molecular Mass: 36.41 kDa
• AA Sequence: PSVITHTASATLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVHPKPVSLTGGRPKQPHKIVPAPKPEPVSLVLKNARIAP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MLXIP MLX interacting protein [ Homo sapiens ]
• Official Symbol: MLXIP
• Synonyms: MLXIP; MLX interacting protein; MLX-interacting protein; bHLHe36; KIAA0867; MIR; MONDOA; MondoA; Mlx interactor; transcriptional activator MondoA; class E basic helix-loop-helix protein 36
• Gene ID: 22877
• mRNA Refseq: NM_014938
• Protein Refseq: NP_055753
• MIM: 608090
• UniProt ID: Q9HAP2