Recombinant Full Length Trk System Potassium Uptake Protein Trkh(Trkh) Protein, His-Tagged
Cat.No. : | RFL30944EF |
Product Overview : | Recombinant Full Length Trk system potassium uptake protein trkH(trkH) Protein (P0AFZ8) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | MHFRAITRIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKE KGELKSREGFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGL DSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAE TAKTLWLIYVLLTVACALALWFAGMDAFDAIGHSFATIAIGGFSTHDASIGYFDSPTINT IIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQFTLVVICTLVLWFHNVYSS ALMTINQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTGGGLKVIRIL LLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATGV DDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEVFTLLVLFTPTF WRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trkH |
Synonyms | trkH; Z5371; ECs4777; Trk system potassium uptake protein TrkH |
UniProt ID | P0AFZ8 |
◆ Recombinant Proteins | ||
CD276-1287M | Recombinant Mouse CD276 protein, Fc-tagged | +Inquiry |
RFL29432SF | Recombinant Full Length Undecaprenyl-Phosphate 4-Deoxy-4-Formamido-L-Arabinose Transferase(Arnc) Protein, His-Tagged | +Inquiry |
AKR1A1-291R | Recombinant Rhesus monkey AKR1A1 Protein, His-tagged | +Inquiry |
ERNI-3631C | Recombinant Chicken ERNI | +Inquiry |
DDIT4L-1470R | Recombinant Rat DDIT4L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
Lactate dehydrogenase-039B | Active Native Bovine Lactate dehydrogenase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSA-3086HCL | Recombinant Human ARSA cell lysate | +Inquiry |
BTBD1-8400HCL | Recombinant Human BTBD1 293 Cell Lysate | +Inquiry |
Esophagus-513D | Dog Esophagus Lysate, Total Protein | +Inquiry |
ADD1-9017HCL | Recombinant Human ADD1 293 Cell Lysate | +Inquiry |
ZNF621-36HCL | Recombinant Human ZNF621 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trkH Products
Required fields are marked with *
My Review for All trkH Products
Required fields are marked with *
0
Inquiry Basket