Recombinant Full Length Undecaprenyl-Phosphate 4-Deoxy-4-Formamido-L-Arabinose Transferase(Arnc) Protein, His-Tagged
Cat.No. : | RFL29432SF |
Product Overview : | Recombinant Full Length Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC) Protein (Q7UC63) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE ASQAENSHIVSILINRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT DVRARPRYFVQQVIRPSSKENE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arnC |
Synonyms | arnC; SF2333; S2466; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase |
UniProt ID | Q7UC63 |
◆ Recombinant Proteins | ||
RFL8213MF | Recombinant Full Length Mouse Epsilon-Sarcoglycan(Sgce) Protein, His-Tagged | +Inquiry |
RFL26361BF | Recombinant Full Length Brucella Melitensis Biotype 1 Sn-Glycerol-3-Phosphate Transport System Permease Protein Ugpe(Ugpe) Protein, His-Tagged | +Inquiry |
HMGCLL1-13846H | Recombinant Human HMGCLL1, His-tagged | +Inquiry |
BSDC1-2066C | Recombinant Chicken BSDC1 | +Inquiry |
SPATA31A2-4115H | Recombinant Human SPATA31A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I-02H | Native Human Collagen type I Protein | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT5-2577HCL | Recombinant Human PRMT5 cell lysate | +Inquiry |
RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
EPHA4-1933HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
CALCA-7895HCL | Recombinant Human CALCA 293 Cell Lysate | +Inquiry |
MCAT-4432HCL | Recombinant Human MCAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All arnC Products
Required fields are marked with *
My Review for All arnC Products
Required fields are marked with *
0
Inquiry Basket