Recombinant Full Length Triticum Aestivum Aluminum-Activated Malate Transporter 1(Almt1) Protein, His-Tagged
Cat.No. : | RFL32014TF |
Product Overview : | Recombinant Full Length Triticum aestivum Aluminum-activated malate transporter 1(ALMT1) Protein (Q76LB1) (1-459aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Triticum aestivum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-459) |
Form : | Lyophilized powder |
AA Sequence : | MDIDHGRESDGEMVGTIASCGLLLHSLLAGLGRRAAGFARKVGGAAREDPRRVAHSLKVG LALALVSVVYFVTPLFNGLGVSAIWAVLTVVVVMEYTVGATLSKGLNRALATLVAGCIAV GAHQLAELAERCGDQGEPIVLTVLVFFVASAATFLRFIPEIKAKYDYGVTIFILTFGLVA VSSYRVEELIQLAHQRFYTIAVGVFICLCTTVFLFPVWAGEDVHKLASGNLDKLAQFIEG MEFNCFGENSVANNFGGKDSPQMHKSVLNSKATEDSLCTFAKWEPRHGQFRFRHPWSQYQ KLGTLCRQCASSMEALASYVITTSKTQCPAAANPELSCKVRKTCGEMSLHSSKVLRDLAM ATRTMTVPSPVNITMATAVKAAESLRSELAENTALLQVMHVAVTATLLADLVDRVKEIAE CVDVLARLAHFKNPEDTKNVVVSTVSRGIDEPLPDVVIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALMT1 |
Synonyms | ALMT1; ALMT1-1; ALMT1-2; Aluminum-activated malate transporter 1; TaALMT1 |
UniProt ID | Q76LB1 |
◆ Recombinant Proteins | ||
NR1H5-6647Z | Recombinant Zebrafish NR1H5 | +Inquiry |
TNFAIP6-42H | Active Recombinant Human TNFAIP6 protein, His-tagged | +Inquiry |
TNFRSF1B-180H | Recombinant Human TNFRSF1B | +Inquiry |
GPNMB-747H | Active Recombinant Human GPNMB, Fc Chimera | +Inquiry |
GRIN1-5664HF | Recombinant Full Length Human GRIN1 Protein | +Inquiry |
◆ Native Proteins | ||
F9-301R | Native Rat Factor IXa | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBQ1-317HCL | Recombinant Human HBQ1 lysate | +Inquiry |
XIAP-263HCL | Recombinant Human XIAP 293 Cell Lysate | +Inquiry |
MLH3-4294HCL | Recombinant Human MLH3 293 Cell Lysate | +Inquiry |
TMEM54-1795HCL | Recombinant Human TMEM54 cell lysate | +Inquiry |
ARMC9-8696HCL | Recombinant Human ARMC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ALMT1 Products
Required fields are marked with *
My Review for All ALMT1 Products
Required fields are marked with *
0
Inquiry Basket