Recombinant Human NDUFA5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDUFA5-5090H |
Product Overview : | NDUFA5 MS Standard C13 and N15-labeled recombinant protein (NP_004991) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. |
Molecular Mass : | 13.5 kDa |
AA Sequence : | MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDUFA5 NADH:ubiquinone oxidoreductase subunit A5 [ Homo sapiens (human) ] |
Official Symbol | NDUFA5 |
Synonyms | NDUFA5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; B13; CI 13kB; CI 13KD B; complex I 13kDa subunit B; NADH ubiquinone oxidoreductase 13 kDa B subunit; NUFM; type I dehydrogenase; ubiquinone reductase; UQOR13; Complex I-13KD-B; complex I subunit B13; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; CI-13kB; CI-13KD-B; FLJ12147; DKFZp781K1356; |
Gene ID | 4698 |
mRNA Refseq | NM_005000 |
Protein Refseq | NP_004991 |
MIM | 601677 |
UniProt ID | Q16718 |
◆ Recombinant Proteins | ||
NDUFA5-3703C | Recombinant Chicken NDUFA5 | +Inquiry |
NDUFA5-734C | Recombinant Cynomolgus NDUFA5 Protein, His-tagged | +Inquiry |
NDUFA5-478C | Recombinant Cynomolgus Monkey NDUFA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndufa5-4331M | Recombinant Mouse Ndufa5 Protein, Myc/DDK-tagged | +Inquiry |
NDUFA5-5090H | Recombinant Human NDUFA5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA5-3917HCL | Recombinant Human NDUFA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFA5 Products
Required fields are marked with *
My Review for All NDUFA5 Products
Required fields are marked with *
0
Inquiry Basket