Recombinant Full Length Treponema Pallidum Uncharacterized Protein Tp_0783 (Tp_0783) Protein, His-Tagged
Cat.No. : | RFL3175TF |
Product Overview : | Recombinant Full Length Treponema pallidum Uncharacterized protein TP_0783 (TP_0783) Protein (O83762) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MKEIARHCTFSPMKIKEKKGYFISFSALFLIAYMFVAAVPLGADPYFLPIWARDLASELH XERPERAVRVNADTVQTLQPFMVGEYFGYFTDZGSVVFATRVTQRLSASTHAWAVYPEHA VRTPVFNPAGEHLAEIAEPGFVHIEADRFFLFSPGGNAVSSYDARGVQRWRVLHTAPITA FHSSAAGAVIGFSDGKVMVVRADGTVRCAFYPGGSTYEIVFGVTLSADGTLAACVCGLDR QRVILVSLADVQCKIVHHQYLEGALRHQLLMNFDTEGRYVVFEHAQGVGVIDCQRLETNI IPLVGDVVGMGVQPECDVVTVLSQKEQRCRFAVFERAVHRVGDVRFDAQDVSLTQGEKKF FLSIDMLLARIDIAGIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TP_0783 |
Synonyms | TP_0783; Uncharacterized protein TP_0783 |
UniProt ID | O83762 |
◆ Recombinant Proteins | ||
RFL813BF | Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Ypdp(Ypdp) Protein, His-Tagged | +Inquiry |
IL1B-559R | Recombinant Rhesus IL1B protein | +Inquiry |
ATP6V1C1-547R | Recombinant Rat ATP6V1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD28-337H | Recombinant Human/Cynomolgus/Rhesus macaque CD28 protein, His-tagged | +Inquiry |
SPR-30401TH | Recombinant Human SPR, His-tagged | +Inquiry |
◆ Native Proteins | ||
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
VIM-186B | Native bovine VIM | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP4R4-2910HCL | Recombinant Human PPP4R4 293 Cell Lysate | +Inquiry |
MTDH-507HCL | Recombinant Human MTDH cell lysate | +Inquiry |
RASSF7-529HCL | Recombinant Human RASSF7 lysate | +Inquiry |
PI4K2A-1350HCL | Recombinant Human PI4K2A cell lysate | +Inquiry |
CDKN2D-7610HCL | Recombinant Human CDKN2D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP_0783 Products
Required fields are marked with *
My Review for All TP_0783 Products
Required fields are marked with *
0
Inquiry Basket