Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Ypdp(Ypdp) Protein, His-Tagged
Cat.No. : | RFL813BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein ypdP(ypdP) Protein (P54163) (1-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-229) |
Form : | Lyophilized powder |
AA Sequence : | MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQVVKTVELFGLTATLGN VMYGTIFFATDVLNEKYGPAEARKAVWLGFSTLLTLTFVMQGVLLFEPASSDISQTALET IFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLLWLRNGGSTAVSQLFDTFIFT AVAFLGIYPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPNDERSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ypdP |
Synonyms | ypdP; BSU21980; Probable queuosine precursor transporter; Q precursor transporter |
UniProt ID | P54163 |
◆ Recombinant Proteins | ||
Erp27-1441R | Recombinant Rat Erp27 Protein, His-tagged | +Inquiry |
VAMP1-12573Z | Recombinant Zebrafish VAMP1 | +Inquiry |
RFL15384HF | Recombinant Full Length Human Olfactory Receptor 1G1(Or1G1) Protein, His-Tagged | +Inquiry |
ACR-0505H | Recombinant Human ACR Protein (Ile43-Gln343), N-His-tagged | +Inquiry |
SERPINF1-32H | Recombinant Human SERPINF1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCD2-9148HCL | Recombinant Human ABCD2 293 Cell Lysate | +Inquiry |
CD19-2005HCL | Recombinant Human CD19 cell lysate | +Inquiry |
HL-60-2148H | HL-60 (human promyelocytic leukemia) nuclear cell lysate | +Inquiry |
METTL17-404HCL | Recombinant Human METTL17 lysate | +Inquiry |
LRP5L-4655HCL | Recombinant Human LRP5L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ypdP Products
Required fields are marked with *
My Review for All ypdP Products
Required fields are marked with *
0
Inquiry Basket