Recombinant Full Length Thermus Thermophilus Nadh-Quinone Oxidoreductase Subunit 7(Nqo7) Protein, His-Tagged
Cat.No. : | RFL36255TF |
Product Overview : | Recombinant Full Length Thermus thermophilus NADH-quinone oxidoreductase subunit 7(nqo7) Protein (Q56217) (1-119aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermus Thermophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-119) |
Form : | Lyophilized powder |
AA Sequence : | MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVH FYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqo7 |
Synonyms | nqo7; TTHA0084; NADH-quinone oxidoreductase subunit 7; NADH dehydrogenase I chain 7; NDH-1 subunit 7 |
UniProt ID | Q56217 |
◆ Recombinant Proteins | ||
iolG-3962B | Recombinant Bacillus subtilis iolG protein, His-SUMO-tagged | +Inquiry |
Sirpa-5668R | Recombinant Rat Sirpa protein, His & T7-tagged | +Inquiry |
GLCB-2133E | Recombinant Escherichia coli GLCB Protein (2-723 aa), His-tagged | +Inquiry |
CSTB-2382H | Recombinant Human CSTB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL11827HF | Recombinant Full Length Human Synaptotagmin-5(Syt5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
AZU1-26565TH | Native Human AZU1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GKN2-5911HCL | Recombinant Human GKN2 293 Cell Lysate | +Inquiry |
Kidney-259H | Human Kidney Cytoplasmic Lysate | +Inquiry |
C7orf23-7973HCL | Recombinant Human C7orf23 293 Cell Lysate | +Inquiry |
AADAC-9160HCL | Recombinant Human AADAC 293 Cell Lysate | +Inquiry |
GUCA1C-5678HCL | Recombinant Human GUCA1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqo7 Products
Required fields are marked with *
My Review for All nqo7 Products
Required fields are marked with *
0
Inquiry Basket