Recombinant Full Length Thermotoga Maritima Methyl-Accepting Chemotaxis Protein 3(Mcp3) Protein, His-Tagged
Cat.No. : | RFL19107TF |
Product Overview : | Recombinant Full Length Thermotoga maritima Methyl-accepting chemotaxis protein 3(mcp3) Protein (Q9X0N0) (1-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermotoga maritima |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-539) |
Form : | Lyophilized powder |
AA Sequence : | MKSVASKLLLGFGLVCAGLVLFGLLTFYNILSLEKIVADTANINRAIVELAINQAGVLVA VQNKDKSLLSSSVEGLRTSLDDIKAYQSDFSGENLKLLQESIAHLEEMIRITDSLIVDGV DQSIYDRFVELQAEIRNPLRKLVQNLGVENVSMTKNIKRNIIFFLVVVCAAAMFIAIFTT RNLTTPLKKLAVLVENLSHGVLNVEIEKIRSKDEIGKAAMAVEKLREILLDIITGINKAS SEVSSSSEELSATSEELSANVNSISEALVSLNKEADENSATLEEFTASIEELSSTADSNS KSAQAMLESTQRVHEQVEKSTERIREITEKAHSTREMSENTKQALNRLLSMAENINSIVD TINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESKAATQQIGEILGKLRD EINNSSKIVESTASAIEETASLVESIKDVFESIRIAMEDVQSRVESVAASTQEQSASLEE LSAGVTRLTELLNKTRENTSSANSALQEANAALEELSASAQSLAELAQELQRRIEFFKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcp3 |
Synonyms | mcp3; TM_1146; Methyl-accepting chemotaxis protein 3 |
UniProt ID | Q9X0N0 |
◆ Native Proteins | ||
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
Ceruloplasmin-019B | Active Native Bovine Ceruloplasmin Protein | +Inquiry |
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf49-8075HCL | Recombinant Human C2orf49 293 Cell Lysate | +Inquiry |
MIOX-4311HCL | Recombinant Human MIOX 293 Cell Lysate | +Inquiry |
ASCC2-8655HCL | Recombinant Human ASCC2 293 Cell Lysate | +Inquiry |
PEX5-3285HCL | Recombinant Human PEX5 293 Cell Lysate | +Inquiry |
FMNL3-659HCL | Recombinant Human FMNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mcp3 Products
Required fields are marked with *
My Review for All mcp3 Products
Required fields are marked with *
0
Inquiry Basket