Recombinant Full Length Teredinibacter Turnerae Upf0761 Membrane Protein Tertu_3006 (Tertu_3006) Protein, His-Tagged
Cat.No. : | RFL17826TF |
Product Overview : | Recombinant Full Length Teredinibacter turnerae UPF0761 membrane protein TERTU_3006 (TERTU_3006) Protein (C5BNZ4) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Teredinibacter turnerae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MQKLVKTWLKRSKRIRGVLLQFSKELFFEFNERGCQRSAAALTYMTLFALVPLMTVTYTM FSAIPAFDGVGDQLNGLIFHHFLPETGEEVSQYLSDFSSQARRLSGVGVVMLLVTAYLML RNIETTFNSIWGVKQARSGLSGYLLYWAILSVGPILVAAAFLLSTYLLSVQIMLEDLDGL GVMQLVYRVVPWALTSAAFTLLFVAVPNCRVPFKFGAIGGVITAFAFEVVKAVFGYIVAN SSFKLIYGAFAVVPLFLLWVNLLWTIILGGAVFVRTLAEHSYASRISRLSDMIVVLICLA LFREKAALGESVSDRDCVRLGIGLVHWQRMRSLMVEHRWIAVTESGDYVLSRDLRRANIW EVASMVRMPVSEELSSLRENIAGRAPWFADFLERQSELRSHAESAFSVSLESLFAAEHEE EKPLTDQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TERTU_3006 |
Synonyms | TERTU_3006; UPF0761 membrane protein TERTU_3006 |
UniProt ID | C5BNZ4 |
◆ Recombinant Proteins | ||
Fam163a-2924M | Recombinant Mouse Fam163a Protein, Myc/DDK-tagged | +Inquiry |
ANGPTL4-3223H | Recombinant Human ANGPTL4 protein, His-tagged | +Inquiry |
CALML5-609R | Recombinant Rhesus monkey CALML5 Protein, His-tagged | +Inquiry |
SLC35F3-8344M | Recombinant Mouse SLC35F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29282OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Cytochrome P450 87A3(Cyp87A3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Eye-644B | Bovine Eye Whole Lysate, Total Protein | +Inquiry |
TPSB2-835HCL | Recombinant Human TPSB2 293 Cell Lysate | +Inquiry |
CCL6-1896MCL | Recombinant Mouse CCL6 cell lysate | +Inquiry |
TRPC5-742HCL | Recombinant Human TRPC5 293 Cell Lysate | +Inquiry |
CTDSP1-7211HCL | Recombinant Human CTDSP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TERTU_3006 Products
Required fields are marked with *
My Review for All TERTU_3006 Products
Required fields are marked with *
0
Inquiry Basket