Recombinant Full Length Synechococcus Sp. Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged
Cat.No. : | RFL23368SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Proton extrusion protein PcxA(pcxA) Protein (Q2JRR7) (1-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-460) |
Form : | Lyophilized powder |
AA Sequence : | MGESVLSRLGQWISSTPLRSLDRAYEAALRIKAIEDRYFQGGSIGSNGNHGQNTSRYFQI QLRQELRQIDLSLAEFRASSVFSRLPDPEQNGSGPPFSSDKDQAKEAPVGPSENDGKDAE NGRQSRDPSILEKLEFIDQVTSRYKRPAAQPRSTSPPPKSQEQPEPLTSSQPEPSDPSIK TNLAKTNLDNSNAPVASKTALLPRSILRTANQIRRELSSQAEEELLQEYRSQRTRTLVAV RFLLLLAILPLLVQIFSKHFLFGPLVDRFQPREPTILALSYEFQEKALSEFEFFKEKIEF ERALHHQSPELDLESEDQLSKKAEELLQKYSRKNLEGLKNVLADVLSLLVFGWLILIGRE EIEVLKSFLDRLIYGLSDSAKAFIIILFTDVFVGYHSPHGWEVLLSSLAAHLGLPENRNF IYGFIATFPVFLDTLFKYWIFRYLNRVSPSAVATYHAMND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcxA |
Synonyms | pcxA; CYA_2560; Proton extrusion protein PcxA |
UniProt ID | Q2JRR7 |
◆ Recombinant Proteins | ||
SE0275-2716S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0275 protein, His-tagged | +Inquiry |
PVR-053H | Active Recombinant Human PVR protein, His/Avi-tagged, Biotinylated | +Inquiry |
Abca8-8143R | Recombinant Rat Abca8 protein, His & T7-tagged | +Inquiry |
NBEA-10446M | Recombinant Mouse NBEA Protein | +Inquiry |
THBS4B-9500Z | Recombinant Zebrafish THBS4B | +Inquiry |
◆ Native Proteins | ||
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
IGHA1-18H | Native Human IgA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC4-7446HCL | Recombinant Human CLIC4 293 Cell Lysate | +Inquiry |
EFNA5-2734HCL | Recombinant Human EFNA5 cell lysate | +Inquiry |
AUP1-54HCL | Recombinant Human AUP1 lysate | +Inquiry |
SYS1-1311HCL | Recombinant Human SYS1 293 Cell Lysate | +Inquiry |
SCARB2-2413MCL | Recombinant Mouse SCARB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pcxA Products
Required fields are marked with *
My Review for All pcxA Products
Required fields are marked with *
0
Inquiry Basket