Recombinant Full Length Thermosynechococcus Elongatus Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged
Cat.No. : | RFL6895TF |
Product Overview : | Recombinant Full Length Thermosynechococcus elongatus Proton extrusion protein PcxA(pcxA) Protein (P59112) (1-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermosynechococcus elongatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-461) |
Form : | Lyophilized powder |
AA Sequence : | MSSNPFIGLRNWIRGAQQWYLTTPKRALQEAYEAALKIRAIELEHFDGQPISPLNLPVGE VSSYFETELKQLLKTIRMRMMEFRASRQILPLAPFQSPPTPVNEGINGATETYTVTATVS STTAEPSVYEKLRVIDATLNRYKRQREKELDALARPSLSRQDPQQRQQAAALDKIAEDSL YLSEYISDDLTSDSKLDSSSFIPRSILRTADRFRRELNSDEATEAEVVRDFRTSKLRTRL AVRFMLLLVILPLLTQQISKALIVSPLVNHFKAVGQIERIINSQLEDNILDELARFENKI RFESLVSNVPIAPEEIQNRIREKAIELSTEYQKELIEPLKNILSDALGFTVFLALVFTGQ RQLAIVKTFLDEVVYGLSDSAKAFMIILFTDVFVGFHSPHGWEVLVNNTLEHFGFPRNED FINMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYKNMNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcxA |
Synonyms | pcxA; tll0748; Proton extrusion protein PcxA |
UniProt ID | P59112 |
◆ Recombinant Proteins | ||
SSBP4-7995Z | Recombinant Zebrafish SSBP4 | +Inquiry |
PKN3-1084H | Recombinant Human Protein Kinase N3, GST-tagged | +Inquiry |
ELAVL2-2840H | Recombinant Human ELAVL2 protein(11-240 aa), C-His-tagged | +Inquiry |
TNF-72H | Recombinant Human TNF, His-tagged | +Inquiry |
G6PC3-2092R | Recombinant Rat G6PC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG2A-015M | Native Mouse IgG2A Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
COL3A1-18B | Native Bovine COL3A1 Protein | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
Spleen-528D | Dog Spleen Lysate, Total Protein | +Inquiry |
GCNT1-5980HCL | Recombinant Human GCNT1 293 Cell Lysate | +Inquiry |
HSPA1A-519HCL | Recombinant Human HSPA1A cell lysate | +Inquiry |
RIMKLA-587HCL | Recombinant Human RIMKLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcxA Products
Required fields are marked with *
My Review for All pcxA Products
Required fields are marked with *
0
Inquiry Basket