Recombinant Full Length Synechococcus Sp. Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged
Cat.No. : | RFL26892SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Proton extrusion protein PcxA(pcxA) Protein (Q5N4M6) (1-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-421) |
Form : | Lyophilized powder |
AA Sequence : | MAFFAGISDWVAQRLQRNSETARLDLERAYEAALYITALETEYASGRSLRRLPSQLSARQ QTSLQAELRQTLRSLRHYRQRYRRHQPVQLQAGLALGRPGMGMPTIAHEKLQLIEQVLAR YGQPTVHSSNPDDSQLMTSKNNSKPVPDPESDDEYLISQTSFLPRSIFGAFADLRQQLDP KAEDQIVQNFRSRKGKTLIALRFVLLLVLVPLLTQQISKSFIVGPIVDRLRSQDPEAIFL NFQMEEEAFVKLNQYQQLLRFQHYLKEAPPLTEAEIDERVREKAEEIAVEYRQESSNAIK NIFADLISAAAFAILLISSQEEIQLLKSFIDEVVYGISDSAKAFIIILFTDIFVGFHSPH GWEVILESISRHFGIPENRSFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMN E |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcxA |
Synonyms | pcxA; syc0553_d; Proton extrusion protein PcxA |
UniProt ID | Q5N4M6 |
◆ Recombinant Proteins | ||
NAE1-26749TH | Recombinant Full Length Human NAE1, His-tagged | +Inquiry |
NFKB1-1846C | Recombinant Chicken NFKB1 protein, His & T7-tagged | +Inquiry |
FKBP8-2013R | Recombinant Rat FKBP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB11BB-676Z | Recombinant Zebrafish RAB11BB | +Inquiry |
Uchl1-7361M | Active Recombinant Full Legnth Mouse Uchl1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
hypogaea 2S-156A | Native Arachis hypogaea 2S protein | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINI1-1658MCL | Recombinant Mouse SERPINI1 cell lysate | +Inquiry |
KCNH2-5059HCL | Recombinant Human KCNH2 293 Cell Lysate | +Inquiry |
ELMO2-6621HCL | Recombinant Human ELMO2 293 Cell Lysate | +Inquiry |
RASGRP3-2504HCL | Recombinant Human RASGRP3 293 Cell Lysate | +Inquiry |
HLA-DOA-5502HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcxA Products
Required fields are marked with *
My Review for All pcxA Products
Required fields are marked with *
0
Inquiry Basket