Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL21974SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (A5GV87) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MKSLVLKAAAWLSDLRVAIVLLLLIAACSGLGTAIPQGEPAAFYHERYDAAPWLGVVNGN QLLSWELDHLYTSNWFLLLLAWLGLALLLCSLRRQWPALRASLRWLDYTKPRQLSKLAVA TSLDTGDSAAALDQLERQLQQQGWAVRRQQNRLAARRGVIGRVGPLLVHTGLIVFMVGAV VGAFGGQRLERFLAPGRSLELLNPQGDTRLELQLDSFAIQRDPAGRPEQFSSQLLLRDGT GAPAQPAAVSVNHPLRHRGITVYQADWGLAAVTMQLGQSPLLQLPLQTFPELGEQVWGLV LPTRPDGSDPVLLALQSELGPVEVYGADSQQLGLLTVGGESQEILGLPLRIADVMPASGL LIKRDPGVPLVYAGFAITLLGGGLSLIATRQLWAISESGRLHIAGLCNRNLVAFADELPK LGSSAITGAPHDAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; SynRCC307_1893; Cytochrome c biogenesis protein CcsB |
UniProt ID | A5GV87 |
◆ Recombinant Proteins | ||
HBB-7865H | Recombinant Human HBB protein, His & GST-tagged | +Inquiry |
RFL7619RF | Recombinant Full Length Rat Olfactory Receptor-Like Protein I9 Protein, His-Tagged | +Inquiry |
Rarres2-826M | Recombinant Mouse Rarres2 Protein, Fc-tagged | +Inquiry |
EFNA1-2238H | Recombinant Human EFNA1 protein(Met1-Ser182), His-tagged | +Inquiry |
BOLA2-553R | Recombinant Rhesus monkey BOLA2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Egf-634M | Active Native Mouse Egf | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRB1F-1757MCL | Recombinant Mouse KLRB1F cell lysate | +Inquiry |
A431-156H | A431 Whole Cell Lysate (Human Epidermoid Carcinoma) | +Inquiry |
CAMK2D-7879HCL | Recombinant Human CAMK2D 293 Cell Lysate | +Inquiry |
NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
RPL31-2206HCL | Recombinant Human RPL31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket