Recombinant Full Length Sun Domain-Containing Protein 1(Sun-1) Protein, His-Tagged
Cat.No. : | RFL24640CF |
Product Overview : | Recombinant Full Length Sun domain-containing protein 1(sun-1) Protein (Q20924) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MALRHTISPQFSNRHSPPVTRSVSRTGVHQPLDTSTPVTRRDSQPGTITGTIQRFHESAD DSEIDLNSSKFIYKEHFSYKEITSMKKEMWYDWLEYRIRMVRRRFVPTWAQFKRTLMAVV LFAMLYKYARDCLFDGTHHNSEGSYADKDANWASEKQKFHQTISNLRAEFSAHDKQLDFK TDHLEKLLENVLEHSKGWKESAIEELKQIKLWQAEISDALQQMKKEIDDAKSTKIIHSTP EKAPETAPTASLPPSSQLQPMHITRRALLGVNVANSLIGASIDHSCSSRPVSAKDGFFYD FMSYFGTFQEGYALLDRDVLSPGEAWCTYDKRATLTVKLARFVIPKSVSYQHVRWSGIVP NHAPKLYDVVACTDSCCTKWQPLVANCEYKERDGSYDEQEQFCSVPTIQNHSPINHVQFR FRENHGDMPKTCAYLIRVYGEPVDPPKETQPMTDNGTESKLESAIVNSVSETA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sun-1 |
Synonyms | sun-1; mtf-1; F57B1.2; Sun domain-containing protein 1 |
UniProt ID | Q20924 |
◆ Recombinant Proteins | ||
PRRXL1-4395R | Recombinant Rat PRRXL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD59-3013HF | Recombinant Full Length Human CD59 Protein, GST-tagged | +Inquiry |
TCF4-29463TH | Recombinant Human TCF4 protein, GST-tagged | +Inquiry |
HMGCL-2867R | Recombinant Rat HMGCL Protein | +Inquiry |
RFL24833SF | Recombinant Full Length Saguinus Oedipus Melanocyte-Stimulating Hormone Receptor(Mc1R) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRNAD1-8147HCL | Recombinant Human C1orf66 293 Cell Lysate | +Inquiry |
LRPPRC-4652HCL | Recombinant Human LRPPRC 293 Cell Lysate | +Inquiry |
TAF12-1276HCL | Recombinant Human TAF12 293 Cell Lysate | +Inquiry |
ZNF692-25HCL | Recombinant Human ZNF692 293 Cell Lysate | +Inquiry |
WISP1-2820HCL | Recombinant Human WISP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sun-1 Products
Required fields are marked with *
My Review for All sun-1 Products
Required fields are marked with *
0
Inquiry Basket