Recombinant Human TCF4 protein, GST-tagged
Cat.No. : | TCF4-29463TH |
Product Overview : | Recombinant Human TCF4 full-length ORF ( AAH31056.1, 1 a.a. - 365 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 65.89kDa |
AA Sequence : | MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGT PYDHTTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQ YSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSD PWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRN |
Applications : | ELISA; WB; Antibody Production; Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TCF4 transcription factor 4 [ Homo sapiens ] |
Official Symbol | TCF4 |
Synonyms | TCF4; transcription factor 4; bHLHb19; E2 2; ITF2; SEF2 1B; SL3-3 enhancer factor 2; transcription factor 4, isoform D; transcription factor 4, isoform R; immunoglobulin transcription factor 2; class B basic helix-loop-helix protein 19; E2-2; PTHS; SEF2; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; MGC149723; MGC149724; |
Gene ID | 6925 |
mRNA Refseq | NM_001083962 |
Protein Refseq | NP_001077431 |
MIM | 602272 |
UniProt ID | P15884 |
Chromosome Location | 18q21.1 |
Pathway | CDO in myogenesis, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; |
Function | DNA binding; E-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; TFIIB-class binding transcription factor activity; TFIIB-class transcription factor binding; protein C-terminus binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; sequence-specific DNA binding RNA polymerase recruiting transcription factor activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
RFL16032AF | Recombinant Full Length Apis Mellifera Rhodopsin, Long-Wavelength Protein, His-Tagged | +Inquiry |
RFL19482IF | Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged | +Inquiry |
BCAM-4517Z | Recombinant Zebrafish BCAM | +Inquiry |
TUBE1-11219Z | Recombinant Zebrafish TUBE1 | +Inquiry |
DUSP19-28073TH | Recombinant Human DUSP19, His-tagged | +Inquiry |
|
◆ Native Proteins | ||
ACHE-8345H | Native Human ACHE | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
IgG1-226H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH2B3-1880HCL | Recombinant Human SH2B3 293 Cell Lysate | +Inquiry |
UBE2V2-559HCL | Recombinant Human UBE2V2 293 Cell Lysate | +Inquiry |
MAPK10-4498HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
TALDO1-1257HCL | Recombinant Human TALDO1 293 Cell Lysate | +Inquiry |
HTR3C-5333HCL | Recombinant Human HTR3C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCF4 Products
Required fields are marked with *
My Review for All TCF4 Products
Required fields are marked with *
0
Inquiry Basket