Recombinant Full Length Streptomyces Coelicolor Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL18651SF |
Product Overview : | Recombinant Full Length Streptomyces coelicolor Protein translocase subunit SecD(secD) Protein (Q53955) (1-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces coelicolor |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-570) |
Form : | Lyophilized powder |
AA Sequence : | MFASGHTTPRLGIDLAGGTSITLRAVPEAGQESAINKTNMDTAVEIMNRRVNGLGVSEAE VQTQGDRNIIVYIPKGTNSKEARQQVGTTAKLYFRPVLATELSGANATGTPSASETGGAS DKATDKATDKATDKATDGDKATDGDKASGTPSDSASASATSQGRAASDALKADPSPSATS SDGASPSPSASASGDDATAKLQQQYAALDCTDKNARAKAGDGAKPDEQTVACGQNSQGQW QKYILGAAAVDGTEVDEAEAVYNTQTAAGWTVTMKFTDKGSKKFADITGKLAQNQSPQNQ FAIVLDNEVVSDPYVSQALTGGNAEISGSFDQEEAQSLANMLSYGALPLTFKEDSVTTVT AALGGEQLKAGLIAGAIGLALVVLYLLFYYRGLSFIAVCSLLVSAGLTYVIMALLGPTIG FALNLPAVCGAIVAIGITADSFIVYFERVRDEIREGRTLRPAVERAWPRARRTILVSDFV SFLAAAVLFIVTVGKVQGFAFTLGLTTLLDVVVVFLFTKPLLTLMARRKFFASGHKWSGL DPKALGAKPPLRRTRRPSRPAAGPVDPKEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; SCO1516; SCL2.06c; Protein translocase subunit SecD |
UniProt ID | Q53955 |
◆ Recombinant Proteins | ||
Pih1d1-4858M | Recombinant Mouse Pih1d1 Protein, Myc/DDK-tagged | +Inquiry |
GPX5-1786R | Recombinant Rhesus Macaque GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NS5-3655J | Recombinant Japanese encephalitis virus NS5 protein, His-SUMO-tagged | +Inquiry |
Car2-7677R | Recombinant Rat Car2 protein, His-tagged | +Inquiry |
GP1BA-21M | Active Recombinant Mouse GP1BA Protein, C-His-tagged | +Inquiry |
◆ Native Proteins | ||
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Tongue-480C | Cat Tongue Lysate, Total Protein | +Inquiry |
HERPUD2-5583HCL | Recombinant Human HERPUD2 293 Cell Lysate | +Inquiry |
RS1-2137HCL | Recombinant Human RS1 293 Cell Lysate | +Inquiry |
Liver-564M | MiniPig Liver Lysate, Total Protein | +Inquiry |
MCM2-4420HCL | Recombinant Human MCM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket