Recombinant Full Length Helicobacter Pylori Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL20913HF |
Product Overview : | Recombinant Full Length Helicobacter pylori Protein translocase subunit SecD(secD) Protein (O26074) (1-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-525) |
Form : | Lyophilized powder |
AA Sequence : | MKLFNARLIVFIGALLLGVGFSVPSLLETKGPKITLGLDLRGGLNMLLGVQTDEALKNKY LSLASALEYNAKKQNILLKDIKSNLEGISFELLDEDEAKKLDALLLELQGHSQFEIKKEA GFYSVNLTPLEQEELRKNTILQVIGIIRNRLDQFGLAEPVVIQQGKEEISVQLPGIKTLE EERRAKDLISRSAHLQMMAVDEEHNKDAMKMTDLEAQKLGSVLLSDVEMGGKILLKAIPI LDGEMLTDAKVVYDQNNQPVVSFTLDAQGAKIFGDFSGANVGKRMAIVLDNKVYSAPVIR ERIGGGSGQISGNFSVAQASDLAIALRSGAMSAPIQVLEKRIIGPSLGKDSVKTSIIALV GGFILVMGFMVLYYSMAGVIACLALVVNLFLIVAVMAIFGATLTLPGMAGIVLTVGIAVD ANIIINERIREVLRENEGIAKAIHLGYINASRAIFDSNITSLIASVLLYAYGTGAIKGFA LTTGIGILASIITAIVGTQGIYQALLPKLTQTKSLYFWFGVNKRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; HP_1550; Protein translocase subunit SecD |
UniProt ID | O26074 |
◆ Recombinant Proteins | ||
TOMM70A-4712R | Recombinant Rhesus Macaque TOMM70A Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF20-8115Z | Recombinant Zebrafish RNF20 | +Inquiry |
TMEM173-3281H | Recombinant Human TMEM173, GST-tagged | +Inquiry |
CD53-98C | Recombinant Cynomolgus CD53, Fc tagged | +Inquiry |
RFL25937EF | Recombinant Full Length Escherichia Coli Inner Membrane Protein Ylac(Ylac) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
CAT-21H | Native Human Catalase Protein | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
TnI-1050H | Native Human Cardiac Troponin I | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODC1-3600HCL | Recombinant Human ODC1 293 Cell Lysate | +Inquiry |
LNPEP-4705HCL | Recombinant Human LNPEP 293 Cell Lysate | +Inquiry |
RDH5-2435HCL | Recombinant Human RDH5 293 Cell Lysate | +Inquiry |
Vagina-562R | Rhesus monkey Vagina Lysate | +Inquiry |
NA-001H9N2CL | Recombinant H9N2 NA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket