Recombinant Full Length Streptococcus Pneumoniae Sensor Protein Ciah(Ciah) Protein, His-Tagged
Cat.No. : | RFL20775SF |
Product Overview : | Recombinant Full Length Streptococcus pneumoniae Sensor protein CiaH(ciaH) Protein (P0A4I6) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYTSVDDKLHGLSENPQA VIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKDFTQLLSGNRFLGLDKI KLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKYAAVLINTSQLEQASQKH EQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVENASHELRTPLAVLQNRLE TLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRDDGIKPELAEVPTSFFNTTF TNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISATD RNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGFGLGLSLAKQIVDALKGTVTV KDNKPKGTIFEVKIAIQTPSKKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ciaH |
Synonyms | ciaH; spr0708; Sensor protein CiaH |
UniProt ID | P0A4I6 |
◆ Recombinant Proteins | ||
SNAP25-2052H | Recombinant Human SNAP25 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-2760H | Recombinant Human DNAJC3 Protein, GST-tagged | +Inquiry |
PRLR-4701R | Recombinant Rat PRLR Protein | +Inquiry |
RFL30584MF | Recombinant Full Length Mouse Cysteinyl Leukotriene Receptor 2(Cysltr2) Protein, His-Tagged | +Inquiry |
RFL33913AF | Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl13(Atl13) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGA-34D | Native Canine Fibrinogen | +Inquiry |
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
KPNA6-4887HCL | Recombinant Human KPNA6 293 Cell Lysate | +Inquiry |
GRB7-5754HCL | Recombinant Human GRB7 293 Cell Lysate | +Inquiry |
BMP2K-8434HCL | Recombinant Human BMP2K 293 Cell Lysate | +Inquiry |
CRTAM-2216HCL | Recombinant Human CRTAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ciaH Products
Required fields are marked with *
My Review for All ciaH Products
Required fields are marked with *
0
Inquiry Basket