Recombinant Full Length Sensor Protein Ciah(Ciah) Protein, His-Tagged
Cat.No. : | RFL34780SF |
Product Overview : | Recombinant Full Length Sensor protein CiaH(ciaH) Protein (P0A4I5) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYTSVDDKLHGLSENPQA VIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKDFTQLLSGNRFLGLDKI KLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKYAAVLINTSQLEQASQKH EQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVENASHELRTPLAVLQNRLE TLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRDDGIKPELAEVPTSFFNTTF TNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISATD RNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGFGLGLSLAKQIVDALKGTVTV KDNKPKGTIFEVKIAIQTPSKKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ciaH |
Synonyms | ciaH; SP_0799; Sensor protein CiaH |
UniProt ID | P0A4I5 |
◆ Recombinant Proteins | ||
PRKACA-3908H | Recombinant Human PRKACA Protein, His (Fc)-Avi-tagged | +Inquiry |
EPS8L2-12507H | Recombinant Human EPS8L2, His-tagged | +Inquiry |
CLU-11356H | Recombinant Human CLU, GST-tagged | +Inquiry |
SUD-0029P2-2499S | Recombinant Staphylococcus aureus (strain: 18807) SUD_0029P2 protein, His-tagged | +Inquiry |
SUPT4H1-4612C | Recombinant Chicken SUPT4H1 | +Inquiry |
◆ Native Proteins | ||
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECP2-4395HCL | Recombinant Human MECP2 293 Cell Lysate | +Inquiry |
ARHGEF40-626HCL | Recombinant Human ARHGEF40 cell lysate | +Inquiry |
TLE2-1050HCL | Recombinant Human TLE2 293 Cell Lysate | +Inquiry |
RDH8-1489HCL | Recombinant Human RDH8 cell lysate | +Inquiry |
C10orf88-8358HCL | Recombinant Human C10orf88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ciaH Products
Required fields are marked with *
My Review for All ciaH Products
Required fields are marked with *
0
Inquiry Basket