Recombinant Full Length Stomatin-1(Sto-1) Protein, His-Tagged
Cat.No. : | RFL18990CF |
Product Overview : | Recombinant Full Length Stomatin-1(sto-1) Protein (Q19200) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MQPSETVEMQEMAQPSGQQRDVEARVQSAPANHSHDAGCTEMFCIAMSYVLIFLTFPVSV FMCIKIVQEYQRAVVFRLGRLVPDVKGPGIFFIIPCIDTFLNIDLRVASYNVPSQEILSR DSVTVSVDAVVYFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTLSEILSDREKIS ADMKISLDEATEPWGIKVERVELRDVRLPSQMQRAMAAEAEATRDAGAKIIAAEGELRAS AALAEAATIISKSEGAMQLRYLHTLNAISSEKTSTIIFPFPMEILGGISKVGSGGTSQNF PVQEMMNAALQSIQRQDTVPATASSSGSRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sto-1 |
Synonyms | sto-1; F08C6.4; Stomatin-1 |
UniProt ID | Q19200 |
◆ Recombinant Proteins | ||
NTN1-0575H | Active Recombinant Human NTN1 protein, His-tagged | +Inquiry |
botB-3840C | Recombinant Clostridium botulinum botB protein, His-B2M-tagged | +Inquiry |
POLR3GL-13111M | Recombinant Mouse POLR3GL Protein | +Inquiry |
ZNF304-5319R | Recombinant Rhesus monkey ZNF304 Protein, His-tagged | +Inquiry |
BCKDK-139H | Recombinant Human BCKDK Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-355S | Native Sheep IgG | +Inquiry |
Lectin-1840S | Active Native Sambucus Nigra Lectin Protein, Cy5 labeled | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
BRPF1-181HCL | Recombinant Human BRPF1 cell lysate | +Inquiry |
SLC39A1-608HCL | Recombinant Human SLC39A1 lysate | +Inquiry |
MOLT-4-1128H | MOLT-4 (human acute lymphoblastic leukemia, T cell) whole cell lysate | +Inquiry |
PRUNE-2796HCL | Recombinant Human PRUNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sto-1 Products
Required fields are marked with *
My Review for All sto-1 Products
Required fields are marked with *
0
Inquiry Basket