Recombinant Full Length Staphylococcus Haemolyticus Upf0365 Protein Sh1343(Sh1343) Protein, His-Tagged
Cat.No. : | RFL4150SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus UPF0365 protein SH1343(SH1343) Protein (Q4L6S3) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MFGLGIIVIAVIIVIALLVLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVIGP LIKAHKAGLNLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLE AVQMSVNPKVIETPFITGVAMNGIEVKAKARITVRANISRLVGGSGEETIIARVGEGIVS TIGSSEHHTQVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDIGKNIGADLQTEQALA DKNIAQAKAEERRAMAVASEQEMKARVQEMRAKVVEAESEVPLAMAEALREGNLGVKDYY NLKNVEADTGMRNAINKRTEQNEDESPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SH1343 |
Synonyms | floA; SH1343; Flotillin-like protein FloA |
UniProt ID | Q4L6S3 |
◆ Recombinant Proteins | ||
SLC34A2-5511R | Recombinant Rat SLC34A2 Protein | +Inquiry |
CDKN2D-623R | Recombinant Rhesus Macaque CDKN2D Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD17B-676H | Recombinant Human ABHD17B Protein, MYC/DDK-tagged | +Inquiry |
GNGT2-5394HF | Recombinant Full Length Human GNGT2 Protein, GST-tagged | +Inquiry |
RFL8853MF | Recombinant Full Length Mouse Transmembrane Protein 186(Tmem186) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Trypsin-51P | Active Native Porcine Trypsin | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIAA0430-990HCL | Recombinant Human KIAA0430 cell lysate | +Inquiry |
MAGOH-1047HCL | Recombinant Human MAGOH cell lysate | +Inquiry |
HeLa-9H | HeLa Whole Cell Lysate - Doxorubicin Stimulated | +Inquiry |
SEMA3B-1981HCL | Recombinant Human SEMA3B 293 Cell Lysate | +Inquiry |
USH1G-477HCL | Recombinant Human USH1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH1343 Products
Required fields are marked with *
My Review for All SH1343 Products
Required fields are marked with *
0
Inquiry Basket