Recombinant Full Length Staphylococcus Epidermidis Probable Quinol Oxidase Subunit 2(Qoxa) Protein, His-Tagged
Cat.No. : | RFL31192SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Probable quinol oxidase subunit 2(qoxA) Protein (Q5HQA9) (20-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-374) |
Form : | Lyophilized powder |
AA Sequence : | CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qoxA |
Synonyms | qoxA; SERP0646; Probable quinol oxidase subunit 2; Quinol oxidase polypeptide II |
UniProt ID | Q5HQA9 |
◆ Recombinant Proteins | ||
HPN-7831M | Recombinant Mouse HPN protein, His-tagged | +Inquiry |
RFL18580MF | Recombinant Full Length Upf0719 Transmembrane Protein Map_1032C(Map_1032C) Protein, His-Tagged | +Inquiry |
LOC494141-4778H | Recombinant Human LOC494141 Protein, GST-tagged | +Inquiry |
CBY1-5152H | Recombinant Human CBY1 Protein, GST-tagged | +Inquiry |
METAP2-6152HF | Recombinant Full Length Human METAP2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
RPE-426 | Native RPE | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spinal-655B | Bovine Spinal Cord Lysate, Total Protein | +Inquiry |
GBA3-661HCL | Recombinant Human GBA3 cell lysate | +Inquiry |
SERPINF2-2750MCL | Recombinant Mouse SERPINF2 cell lysate | +Inquiry |
TRMT2B-427HCL | Recombinant Human TRMT2B cell lysate | +Inquiry |
MGAT2-407HCL | Recombinant Human MGAT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All qoxA Products
Required fields are marked with *
My Review for All qoxA Products
Required fields are marked with *
0
Inquiry Basket