Recombinant Human LOC494141 Protein, GST-tagged

• Cat.No.: LOC494141-4778H
• Product Overview: Human LOC494141 full-length ORF ( AAH56262.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LOC494141 (Solute Carrier Family 25 Member 51 Pseudogene) is a Pseudogene.
• Molecular Mass: 43.9 kDa
• AA Sequence: MKKEELKQHDGFRSSWKETTNTNIFETRYVTSYYRFSEMKHYLCGCCAAFNNVAITFLIQKVLFPQQLYGIKTGDAILQLRTDGFRNLYRGIFPRLMQKTTTLALTFGLYEDLSYLLHKHVSAPEFATCGVAAVLAGTTEAIFTSDIASRPQAP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC494141 solute carrier family 25 member 51 pseudogene [ Homo sapiens (human) ]
• Official Symbol: LOC494141
• Synonyms: LOC494141; solute carrier family 25 member 51 pseudogene; mitochondrial carrier triple repeat 1 pseudogene
• Gene ID: 494141