Recombinant Full Length Staphylococcus Epidermidis Cardiolipin Synthase 2(Cls2) Protein, His-Tagged
Cat.No. : | RFL21189SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Cardiolipin synthase 2(cls2) Protein (Q8CNK3) (1-488aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-488) |
Form : | Lyophilized powder |
AA Sequence : | MALHQSNIIINILLVSAFLLNLVFAFIIIFMERRTANSIWAWLLVLVFLPLVGFILYLLL GRQIQREHIFKLAKEDKVGLEMIVDEQLEALKKQDFSKGNHQIVKFKEMVQMLLYNNAAF LTTDNDLTIYTDGHQKFDDLINDIRHAQSYIHIQYYIIHSDNLGKQLLHELEKKAEEGIE VKMLYDDMGSRDLRKKDLKKFRQKGGHAESFFPSKLPLINLRMNNRNHRKIVVIDGTIGY VGGFNVGDEYIGKSKKFGYWRDTHLRIKGDAVNALQLRFILDWNSQSTRDNLTYESRYFP DVDSGGTIGIQIASSGPDEDWEQIKYGYLKMISSAKESIYIQSPYFIPDQAFLDSIKIAA LGGVDVNIMVPNKRDHPFVYWATLKNVASLLEAGVNVYHYDNGFLHSKTLVIDDEVASVG TANMDNRSFTLNFEVNAFIYDEGVARSLKQAFINDMKLSNKLTSEEYAKRNLLVKFKEGI SQLLSPIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls2 |
Synonyms | cls2; SE_1687; Cardiolipin synthase 2; CL synthase 2 |
UniProt ID | Q8CNK3 |
◆ Native Proteins | ||
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-562M | MiniPig Heart Lysate, Total Protein | +Inquiry |
SCNN1B-2028HCL | Recombinant Human SCNN1B 293 Cell Lysate | +Inquiry |
ZZZ3-9177HCL | Recombinant Human ZZZ3 293 Cell Lysate | +Inquiry |
ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
CD2-1372RCL | Recombinant Rat CD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls2 Products
Required fields are marked with *
My Review for All cls2 Products
Required fields are marked with *
0
Inquiry Basket