Recombinant Full Length Staphylococcus Epidermidis Cardiolipin Synthase 1(Cls1) Protein, His-Tagged
Cat.No. : | RFL17859SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Cardiolipin synthase 1(cls1) Protein (Q5HPM5) (1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-490) |
Form : | Lyophilized powder |
AA Sequence : | MNFGFLGTILTILLVVGFITNVVLAFVIIFLERDRRTASSTWAWLFVLFVLPVIGFILYL FLGRTVSKKKMEKNNGDELHAFEDLVQDQIDSFDKHNYGYINDQVIKHRDLIRMLLMKQD AFLTENNKIDLFTDGHKLYEKVLEDIYNAQDYIHLEYYTFELDGLGKRILDALETKLKEG LEVKLLYDDVGSKKVRLSKFKHFRALGGEVEAFFPSKVPLINFRMNNRNHRKIIIIDGQI GYIGGFNVGDDYLGLGKLGYWRDTHTRVQGEVIDALQLRFILDWNSQSHRPQFKFDQKYF PKKIGDKGNAAIQIASSGPAFDLHQIEYGYTKMIMSAKKSIYLQSPYFIPDQSYINALKM AANSGVEVNLMIPCKPDHPFVYWATFSNAADLLDSGVNIYTYQNGFIHSKILMIDDEISS IGSANMDFRSFELNFEVNAFIYDEDIAKQLRQAFEKDIEQSKLLTKKVYDKRPLSIKFKE GLAKLISPIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls1 |
Synonyms | cls1; SERP0885; Cardiolipin synthase 1; CL synthase 1 |
UniProt ID | Q5HPM5 |
◆ Recombinant Proteins | ||
CDH1-6277H | Recombinant Human CDH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADAM20-2722H | Recombinant Human ADAM20 protein, GST-tagged | +Inquiry |
LRRC3B-129H | Recombinant Human LRRC3B, His-tagged | +Inquiry |
CD7-3029HF | Recombinant Full Length Human CD7 Protein, GST-tagged | +Inquiry |
SLC14A1-5432R | Recombinant Rat SLC14A1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1862W | Active Native Wheat Germ Agglutinin Protein, Rhodamine labeled | +Inquiry |
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
Trypsin-51P | Active Native Porcine Trypsin | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGC-1705RCL | Recombinant Rat PGC cell lysate | +Inquiry |
Duodenum-524D | Dog Duodenum Lysate, Total Protein | +Inquiry |
HMBOX1-5485HCL | Recombinant Human HMBOX1 293 Cell Lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
KLF2-4928HCL | Recombinant Human KLF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls1 Products
Required fields are marked with *
My Review for All cls1 Products
Required fields are marked with *
0
Inquiry Basket