Recombinant Human ADAM20 protein, GST-tagged
Cat.No. : | ADAM20-2722H |
Product Overview : | Recombinant Human ADAM20 protein(492-693 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 492-693 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGTTYVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHLSQACQPKTCNMR |
Gene Name | ADAM20 ADAM metallopeptidase domain 20 [ Homo sapiens ] |
Official Symbol | ADAM20 |
Synonyms | ADAM20; ADAM metallopeptidase domain 20; a disintegrin and metalloproteinase domain 20; disintegrin and metalloproteinase domain-containing protein 20; ADAM 20; |
Gene ID | 8748 |
mRNA Refseq | NM_003814 |
Protein Refseq | NP_003805 |
MIM | 603712 |
UniProt ID | O43506 |
◆ Recombinant Proteins | ||
SERPINA1-5334R | Recombinant Rat SERPINA1 Protein | +Inquiry |
SERPINA1-1973H | Recombinant Human SERPINA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA1-264HFL | Active Recombinant Full Length Human SERPINA1 Protein, C-Flag-tagged | +Inquiry |
a1AT-3308R | Recombinant Rat a1AT, His-tagged | +Inquiry |
SERPINA1-4841Z | Recombinant Zebrafish SERPINA1 | +Inquiry |
◆ Native Proteins | ||
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA1-2856HCL | Recombinant Human SERPINA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA1 Products
Required fields are marked with *
My Review for All SERPINA1 Products
Required fields are marked with *
0
Inquiry Basket