Recombinant Full Length Staphylococcus Aureus Upf0754 Membrane Protein Sav1846(Sav1846) Protein, His-Tagged
Cat.No. : | RFL17893SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0754 membrane protein SAV1846(SAV1846) Protein (Q99T32) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFHEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASNQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAV1846 |
Synonyms | SAV1846; UPF0754 membrane protein SAV1846 |
UniProt ID | Q99T32 |
◆ Recombinant Proteins | ||
HABP2-21H | Recombinant Human HABP2 protein, His-tagged | +Inquiry |
IL19-14165H | Recombinant Human IL19, His-tagged | +Inquiry |
ATF7-2563H | Recombinant Human ATF7 protein, GST-tagged | +Inquiry |
KIF20A-13H | Active Recombinant Human KIF20A Protein,His-tagged | +Inquiry |
GSTP1-0313H | Recombinant Human GSTP1 Protein (M1-Q210), Tag Free | +Inquiry |
◆ Native Proteins | ||
TcdA-188C | Active Native Clostridium difficile Toxin A Protein | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
OAS3-3613HCL | Recombinant Human OAS3 293 Cell Lysate | +Inquiry |
KRT18-4877HCL | Recombinant Human KRT18 293 Cell Lysate | +Inquiry |
TAC1-1290HCL | Recombinant Human TAC1 293 Cell Lysate | +Inquiry |
KIRREL3-1921MCL | Recombinant Mouse KIRREL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAV1846 Products
Required fields are marked with *
My Review for All SAV1846 Products
Required fields are marked with *
0
Inquiry Basket