Recombinant Human HABP2 protein, His-tagged
Cat.No. : | HABP2-21H |
Product Overview : | Recombinant Human HABP2(Met1-Gln279) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-279 a.a. |
Description : | Hyaluronan-binding protein 2(HABP2) is an extracellular serine protease which binds hyaluronic acid. It secreted as an inactive single-chain precursor and is then activated to a heterodimeric form, which consists of a 50 kDa heavy and a 27 kDa light chain linked by a disulfide bond. HABP2 is involved in cell adhesion, it can cleave the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' , but not the gamma-chain of fibrinogen. As a result of this, it does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly. It does not cleave prothrombin and plasminogen but converts the inactive single chain urinary plasminogen activator to the active two chain form, activates coagulation factor VII. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 . |
AA Sequence : | MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLTHAENP DWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPCGRGQCLITQS PPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCY VGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIK VTNDKVKWEYCDVSACSAQAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | HABP2 hyaluronan binding protein 2 [ Homo sapiens ] |
Official Symbol | HABP2 |
Synonyms | HABP2; hyaluronan binding protein 2; hyaluronan-binding protein 2; factor VII activating protein; FSAP; HABP; HGFAL; PHBP; plasma hyaluronan binding protein; factor VII-activating protease; factor seven-activating protease; hyaluronic acid binding protein 2; plasma hyaluronan-binding protein; hepatocyte growth factor activator-like protein; |
Gene ID | 3026 |
mRNA Refseq | NM_001177660 |
Protein Refseq | NP_001171131 |
MIM | 603924 |
UniProt ID | Q14520 |
Chromosome Location | 10q25.3 |
Function | glycosaminoglycan binding; peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
HABP2-21H | Recombinant Human HABP2 protein, His-tagged | +Inquiry |
HABP2-4392H | Recombinant Human HABP2 protein, His-SUMO-tagged | +Inquiry |
HABP2-3418HF | Recombinant Full Length Human HABP2 Protein, GST-tagged | +Inquiry |
HABP2-2779R | Recombinant Rat HABP2 Protein | +Inquiry |
HABP2-2433R | Recombinant Rat HABP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HABP2-5649HCL | Recombinant Human HABP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HABP2 Products
Required fields are marked with *
My Review for All HABP2 Products
Required fields are marked with *
0
Inquiry Basket