Recombinant Full Length Staphylococcus Aureus Upf0754 Membrane Protein Sahv_1831 (Sahv_1831) Protein, His-Tagged
Cat.No. : | RFL17664SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0754 membrane protein SAHV_1831 (SAHV_1831) Protein (A7X3V5) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFHEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASNQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAHV_1831 |
Synonyms | SAHV_1831; UPF0754 membrane protein SAHV_1831 |
UniProt ID | A7X3V5 |
◆ Recombinant Proteins | ||
Ereg-198M | Recombinant Mouse Epiregulin | +Inquiry |
Fgfr2-1501R | Recombinant Rat Fgfr2 Protein, His-tagged | +Inquiry |
KIAA1279-322H | Recombinant Human KIAA1279 | +Inquiry |
DDX3Y-2587HF | Recombinant Full Length Human DDX3Y Protein, GST-tagged | +Inquiry |
WDR4-6738Z | Recombinant Zebrafish WDR4 | +Inquiry |
◆ Native Proteins | ||
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE8A-3339HCL | Recombinant Human PDE8A 293 Cell Lysate | +Inquiry |
SPG20-1519HCL | Recombinant Human SPG20 293 Cell Lysate | +Inquiry |
CFC1-339HCL | Recombinant Human CFC1 cell lysate | +Inquiry |
DLL4-2495MCL | Recombinant Mouse DLL4 cell lysate | +Inquiry |
CACNA2D4-143HCL | Recombinant Human CACNA2D4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAHV_1831 Products
Required fields are marked with *
My Review for All SAHV_1831 Products
Required fields are marked with *
0
Inquiry Basket