Recombinant Full Length Staphylococcus Aureus Upf0365 Protein Sahv_1560 (Sahv_1560) Protein, His-Tagged
Cat.No. : | RFL28790SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0365 protein SAHV_1560 (SAHV_1560) Protein (A7X2X2) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAHV_1560 |
Synonyms | floA; SAHV_1560; Flotillin-like protein FloA |
UniProt ID | A7X2X2 |
◆ Recombinant Proteins | ||
ALDH1B1-1040HFL | Recombinant Full Length Human ALDH1B1 Protein, C-Flag-tagged | +Inquiry |
VEGFA-568H | Recombinant Human VEGFA Protein, Biotinylated | +Inquiry |
FBRS-3883H | Recombinant Human FBRS Protein, GST-tagged | +Inquiry |
SH-RS06965-5579S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS06965 protein, His-tagged | +Inquiry |
Cd200r1-458M | Active Recombinant Mouse Cd200r1, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
SAA-256H | Native Human Serum amyloid A Protein | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREB3L2-7288HCL | Recombinant Human CREB3L2 293 Cell Lysate | +Inquiry |
TCHP-660HCL | Recombinant Human TCHP lysate | +Inquiry |
FAM92B-6339HCL | Recombinant Human FAM92B 293 Cell Lysate | +Inquiry |
ACSF3-1001HCL | Recombinant Human ACSF3 cell lysate | +Inquiry |
OBP2A-3609HCL | Recombinant Human OBP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SAHV_1560 Products
Required fields are marked with *
My Review for All SAHV_1560 Products
Required fields are marked with *
0
Inquiry Basket