Recombinant Full Length Human ALDH1B1 Protein, C-Flag-tagged
Cat.No. : | ALDH1B1-1040HFL |
Product Overview : | Recombinant Full Length Human ALDH1B1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.3 kDa |
AA Sequence : | MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLD EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLK RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN GRELGEDGLKAYTEVKTVTIKVPQKNSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Histidine metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | ALDH1B1 aldehyde dehydrogenase 1 family member B1 [ Homo sapiens (human) ] |
Official Symbol | ALDH1B1 |
Synonyms | ALDH5; ALDHX |
Gene ID | 219 |
mRNA Refseq | NM_000692.5 |
Protein Refseq | NP_000683.3 |
MIM | 100670 |
UniProt ID | P30837 |
◆ Recombinant Proteins | ||
ALDH1B1-618R | Recombinant Rat ALDH1B1 Protein | +Inquiry |
ALDH1B1-489H | Recombinant Human Aldehyde Dehydrogenase 1 Family, Member B1, His-tagged | +Inquiry |
ALDH1B1-312H | Recombinant Human ALDH1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDH1B1-4893M | Recombinant Mouse Aldh1b1 Protein, Myc/DDK-tagged | +Inquiry |
ALDH1B1-490H | Recombinant Human Aldehyde Dehydrogenase 1 Family, Member B1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1B1-16HCL | Recombinant Human ALDH1B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALDH1B1 Products
Required fields are marked with *
My Review for All ALDH1B1 Products
Required fields are marked with *
0
Inquiry Basket